missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ Human NDUFS4 Partial ORF (NP_002486, 66 a.a. - 175 a.a.) Recombinant Protein with GST-tag at N-terminal Product Code.: 16131775

Abnova™ Human NDUFS4 Partial ORF (NP_002486, 66 a.a. - 175 a.a.) Recombinant Protein with GST-tag at N-terminal

Code produit. 16131775
10 ug, 10µg
missing translation for 'orderingAttributeHoverText'
Quantity:
10 ug
25 ug
missing translation for 'unitSize'
10µg
25µg
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Product Code. 16131775

Brand: Abnova™ H00004724Q01.10ug

Please to purchase this item. Need a web account? Register with us today!

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
View alternative products

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Used for AP, Array, ELISA, WB-Re

This gene encodes an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), or NADH:ubiquinone oxidoreductase, the first multi-subunit enzyme complex of the mitochondrial respiratory chain. Complex I plays a vital role in cellular ATP production, the primary source of energy for many crucial processes in living cells. It removes electrons from NADH and passes them by a series of different protein-coupled redox centers to the electron acceptor ubiquinone. In well-coupled mitochondria, the electron flux leads to ATP generation via the building of a proton gradient across the inner membrane. Complex I is composed of at least 41 subunits, of which 7 are encoded by the mitochondrial genome and the remainder by nuclear genes. [provided by RefSeq]

Sequence: GVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK

Spécification

Accession Number NP_002486
For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 4724
Molecular Weight (g/mol) 37.84kDa
Name NDUFS4 (Human) Recombinant Protein (Q01)
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 10 ug
Immunogen GVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias AQDQ
Common Name NDUFS4
Gene Symbol NDUFS4
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Expression System wheat germ expression system
Form Liquid
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit
Abnova™ Human NDUFS4 Partial ORF (NP_002486, 66 a.a. - 175 a.a.) Recombinant Protein with GST-tag at N-terminal >

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis