missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human NKX2-3 Partial ORF (NP_660328.1, 1 a.a. - 56 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00159296-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16132237

  • 6150.00 SEK / 25µg
Estimated Shipment: 26-09-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

NKX2C is a member of the NKX family of homeodomain-containing transcription factors, which are implicated in many aspects of cell type specification and maintenance of differentiated tissue functions. See Harvey (1996) [PubMed 8812123] for a review of the structure, regulation, function, and evolution of NK2 homeobox genes with an emphasis on their roles in heart development.[supplied by OMIM]

Sequence: MMLPSPVTSTPFSVKDILNLEQQHQHFHGAHLQADLEHHFHSAPCMLAAAEGTQFS
Specifications

Specifications

NP_660328.1
Liquid
159296
NKX2-3 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CSX3/NK2.3/NKX2.3/NKX2C/NKX4-3
NKX2-3
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
31.9kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MMLPSPVTSTPFSVKDILNLEQQHQHFHGAHLQADLEHHFHSAPCMLAAAEGTQFS
RUO
NKX2-3
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers