missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human NOS2A Partial ORF (NP_000616, 685 a.a. - 794 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00004843-Q01.25ug

 View more versions of this product

Product Code. 16102005

  • 7020.00 SEK / 25µg

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Description

Nitric oxide is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission and antimicrobial and antitumoral activities. This gene encodes a nitric oxide synthase which is expressed in liver and is inducible by a combination of lipopolysaccharide and certain cytokines. Three related pseudogenes are located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq]

Sequence: DVRGKQHIQIPKLYTSNVTWDPHHYRLVQDSQPLDLSKALSSMHAKNVFTMRLKSRQNLQSPTSSRATILVELSCEDGQGLNYLPGEHLGVCPGNQPALVQGILERVVDG
Specifications
Show More
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

One moment while we fetch your results.
Certificates
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
Abnova™ Human NOS2A Partial ORF (NP_000616, 685 a.a. - 794 a.a.) Recombinant Protein with GST-tag at N-terminal > 25ÎĽg

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.