missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human NPHP4 Full-length ORF (AAH50076.1, 1 a.a. - 81 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00261734-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16119783

  • 5854.80 SEK / 25µg
Estimated Shipment: 20-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a protein which contains a proline-rich region. The encoded protein may function in renal tubular development and function. This protein interacts with nephrocystin. Mutations in this gene are associated with nephronophthisis type 4. Multiple alternative transcript variants have been described but their full-length nature has not been determined. [provided by RefSeq]

Sequence: MCGAFSTQAGAVEKTLFDISPAPGAPVGMLGEDPPVHVRCSDPNVICETQNVGPGEPRDIFLKVASGPSPEIKDFFVIIYS
Specifications

Specifications

AAH50076.1
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.9kDa
Glutathione Sepharose 4 Fast Flow
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
KIAA0673/SLSN4
NPHP4
Yes
wheat germ expression system
Liquid
261734
NPHP4 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MCGAFSTQAGAVEKTLFDISPAPGAPVGMLGEDPPVHVRCSDPNVICETQNVGPGEPRDIFLKVASGPSPEIKDFFVIIYS
RUO
NPHP4
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers