missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ Human NR4A1 Partial ORF (AAH16147, 191 a.a. - 280 a.a.) Recombinant Protein with GST-tag at N-terminal Product Code.: 16136261
  1. Home
  2. Products
  3. Recombinant Proteins
  4. Abnova™ Human NR4A1 Partial ORF (AAH16147, 191 a.a. - 280 a.a.) Recombinant Protein with GST-tag at N-terminal

Abnova™ Human NR4A1 Partial ORF (AAH16147, 191 a.a. - 280 a.a.) Recombinant Protein with GST-tag at N-terminal

Product Code. 16136261
10 ug, 10µg
Click to view available options
Quantity:
10 ug
25 ug
Unit Size:
10µg
25µg
This item is not returnable. View return policy

Product Code. 16136261

Brand: Abnova™ H00003164Q01.10ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Used for AP, Array, ELISA, WB-Re

This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. Expression is induced by phytohemagglutinin in human lymphocytes and by serum stimulation of arrested fibroblasts. The encoded protein acts as a nuclear transcription factor. Translocation of the protein from the nucleus to mitochondria induces apoptosis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq]

Sequence: SFSPPTGPSPSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYG

Specifications

Accession Number AAH16147
For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 3164
Molecular Weight (g/mol) 35.53kDa
Name NR4A1 (Human) Recombinant Protein (Q01)
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 10 ug
Immunogen SFSPPTGPSPSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYG
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias GFRP1/HMR/MGC9485/N10/NAK-1/NGFIB/NP10/NUR77/TR3
Common Name NR4A1
Gene Symbol NR4A1
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Expression System wheat germ expression system
Form Liquid
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
Abnova™ Human NR4A1 Partial ORF (AAH16147, 191 a.a. - 280 a.a.) Recombinant Protein with GST-tag at N-terminal >

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.