missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ Human OR1F1 Full-length ORF (NP_036492.1, 1 a.a. - 312 a.a.) Recombinant Protein with GST-tag at N-terminal Product Code.: 16118601
  1. Home
  2. Products
  3. Recombinant Proteins
  4. Abnova™ Human OR1F1 Full-length ORF (NP_036492.1, 1 a.a. - 312 a.a.) Recombinant Protein with GST-tag at N-terminal

Abnova™ Human OR1F1 Full-length ORF (NP_036492.1, 1 a.a. - 312 a.a.) Recombinant Protein with GST-tag at N-terminal

Product Code. 16118601
10 ug, 10µg
Click to view available options
Quantity:
10 ug
25 ug
Unit Size:
10µg
25µg
This item is not returnable. View return policy

Product Code. 16118601

Brand: Abnova™ H00004992P01.10ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Used for AP, Array, ELISA, WB-Re

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq]

Sequence: MSGTNQSSVSEFLLLGLSRQPQQQHLLFVFFLSMYLATVLGNLLIILSVSIDSCLHTPMYFFLSNLSFVDICFSFTTVPKMLANHILETQTISFCGCLTQMYFVFMFVDMDNFLLAVMAYDHFVAVCHPLHYTAKMTHQLCALLVAGLWVVANLNVLLHTLLMAPLSFCADNAITHFFCDVTPLLKLSCSDTHLNEVIILSEGALVMITPFLCILASYMHITCTVLKVPSTKGRWKAFSTCGSHLAVVLLFYSTIIAVYFNPLSSHSAEKDTMATVLYTVVTPMLNPFIYSLRNRYLKGALKKVVGRVVFSV

Specifications

Accession Number NP_036492.1
For Use With (Application) Antibody Production, Protein Array, ELISA, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 4992
Molecular Weight (g/mol) 61.3kDa
Name OR1F1 (Human) Recombinant Protein (P01)
Purification Method Glutathione Sepharose 4 Fast Flow
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 10 ug
Immunogen MSGTNQSSVSEFLLLGLSRQPQQQHLLFVFFLSMYLATVLGNLLIILSVSIDSCLHTPMYFFLSNLSFVDICFSFTTVPKMLANHILETQTISFCGCLTQMYFVFMFVDMDNFLLAVMAYDHFVAVCHPLHYTAKMTHQLCALLVAGLWVVANLNVLLHTLLMAPLSFCADNAITHFFCDVTPLLKLSCSDTHLNEVIILSEGALVMITPFLCILASYMHITCTVLKVPSTKGRWKAFSTCGSHLAVVLLFYSTIIAVYFNPLSSHSAEKDTMATVLYTVVTPMLNPFIYSLRNRYLKGALKKVVGRVVFSV
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias OLFMF/OR16-36/OR16-37/OR16-88/OR16-89/OR16-90/OR1F10/OR1F13P/OR1F4/OR1F5/OR1F6/OR1F7/OR1F8/OR1F9/OR3-145/ORL1023
Common Name OR1F1
Gene Symbol OR1F1
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Expression System wheat germ expression system
Form Liquid
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
Abnova™ Human OR1F1 Full-length ORF (NP_036492.1, 1 a.a. - 312 a.a.) Recombinant Protein with GST-tag at N-terminal >

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.