missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PART1 Full-length ORF (AAH69304.1, 1 a.a. - 59 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00025859-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16107832

  • 4055.00 SEK / 10µg
Estimated Shipment: 07-10-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene is induced by androgen in prostate adenocarcinoma cells. Multiple alternatively transcript variants have been described for this gene, none of which are predicted to encode a protein product. [provided by RefSeq]

Sequence: MQCQLFRTETSKAVSELNYDYICIKAGTGRPQGTPTIGLVLLVRWAIIYETELQSQPIT
Specifications

Specifications

AAH69304.1
Liquid
25859
PART1 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MQCQLFRTETSKAVSELNYDYICIKAGTGRPQGTPTIGLVLLVRWAIIYETELQSQPIT
RUO
PART1
Wheat Germ (in vitro)
GST
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
33kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DKFZp586D0823
PART1
Yes
wheat germ expression system
Videos
SDS
Documents
Certificates
Special Offers

Special Offers