missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PART1 Full-length ORF (AAH69304.1, 1 a.a. - 59 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

4055.00 SEK - 6150.00 SEK

Specifications

Name PART1 (Human) Recombinant Protein (P01)
Recombinant Yes
Purification Method Glutathione Sepharose 4 Fast Flow
For Use With (Application) Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
Molecular Weight 33kDa
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
16117832
View Documents Promotion Details
Abnova™
H00025859-P01.25UG
25 ug
6150.00 SEK
25µg
View alternative products
Save Up to 
»
Estimated Shipment: 11-08-2022
to see stock.
Please to purchase this item. Need a web account? Register with us today!
16107832
View Documents Promotion Details
Abnova™
H00025859-P01.10UG
10 ug
4055.00 SEK
10µg
View alternative products
Save Up to 
»
Estimated Shipment: 11-08-2022
to see stock.
Please to purchase this item. Need a web account? Register with us today!
Description

Description

This gene is induced by androgen in prostate adenocarcinoma cells. Multiple alternatively transcript variants have been described for this gene, none of which are predicted to encode a protein product. [provided by RefSeq]

Sequence: MQCQLFRTETSKAVSELNYDYICIKAGTGRPQGTPTIGLVLLVRWAIIYETELQSQPIT
Specifications

Specifications

PART1 (Human) Recombinant Protein (P01)
Glutathione Sepharose 4 Fast Flow
33kDa
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
SDS
Product Certifications