missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PCMT1 Partial ORF (NP_005380, 117 a.a. - 225 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00005110-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16162445

  • 4055.00 SEK / 10µg
Estimated Shipment: 18-07-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Three classes of protein carboxyl methyltransferases, distinguished by their methyl-acceptor substrate specificity, have been found in prokaryotic and eukaryotic cells. The type II enzyme catalyzes the transfer of a methyl group from S-adenosyl-L-methionine to the free carboxyl groups of D-aspartyl and L-isoaspartyl residues. These methyl-accepting residues result from the spontaneous deamidation, isomerization, and racemization of normal L-aspartyl and L-asparaginyl residues and represent sites of covalent damage to aging proteins PCMT1 (EC 2.1.1.77) is a protein repair enzyme that initiates the conversion of abnormal D-aspartyl and L-isoaspartyl residues to the normal L-aspartyl form.[supplied by OMIM]

Sequence: DDSVNNVRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQDGSIKMKPLMGVIYVPLTDKEKQWSR
Specifications

Specifications

NP_005380
Liquid
5110
PCMT1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PCMT1
Wheat Germ (in vitro)
GST
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.73kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
DDSVNNVRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQDGSIKMKPLMGVIYVPLTDKEKQWSR
RUO
PCMT1
Yes
wheat germ expression system
Videos
SDS
Documents
Certificates
Special Offers

Special Offers