missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PDYN Partial ORF (NP_077722.1, 205 a.a. - 254 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00005173-Q02.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16014525

  • 4515.00 SEK / 10µg
Estimated Shipment: 23-05-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene is a preproprotein that is proteolytically processed to form the secreted opioid peptides beta-neoendorphin, dynorphin, leu-enkephalin, rimorphin, and leumorphin. These peptides are ligands for the kappa-type of opioid receptor. Dynorphin is involved in modulating responses to several psychoactive substances, including cocaine. [provided by RefSeq]

Sequence: KRYGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVTRSQEDPNAYSGELFDA
Specifications

Specifications

NP_077722.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
31.24kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
KRYGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVTRSQEDPNAYSGELFDA
RUO
PDYN
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
5173
PDYN (Human) Recombinant Protein (Q02)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC26418/PENKB
PDYN
Recombinant
wheat germ expression system
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers