missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PI4KII Partial ORF (NP_060895.1, 383 a.a. - 477 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00055361-Q01.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16055555

  • 3234.00 SEK / 10µg


Estimated Shipment
03-02-2021
Add to basket

Description

Description

Sequence: LILPKISDPNFVKDLEEDLYELFKKDPGFDRGQFHKQIAVMRGQILNLTQALKDNKSPLHLVQMPPVIVETARSHQRSSSESYTQSFQSRKPFFS
Specifications

Specifications

NP_060895.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.19kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
LILPKISDPNFVKDLEEDLYELFKKDPGFDRGQFHKQIAVMRGQILNLTQALKDNKSPLHLVQMPPVIVETARSHQRSSSESYTQSFQSRKPFFS
RUO
PI4K2A
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
55361
PI4KII (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DKFZp761G1923|PI4KII|PIK42A|RP11-548K23.6
PI4K2A
Yes
Videos
SDS
Documents