missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PIN4 Partial ORF (NP_006214, 61 a.a. - 156 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

3970.00 SEK - 6025.00 SEK

Specifications

Accession Number NP_006214
For Use With (Application) Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Format Liquid
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 5303
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
16132845
View Documents Promotion Details
Abnova™
H00005303-Q01.25UG
25 ug
6025.00 SEK
25µg
View alternative products
Save Up to 
»
Estimated Shipment: 08-03-2023
to see stock.
Please to purchase this item. Need a web account? Register with us today!
16122845
View Documents Promotion Details
Abnova™
H00005303-Q01.10UG
10 ug
3970.00 SEK
10µg
View alternative products
Save Up to 
»
Estimated Shipment: 08-03-2023
to see stock.
Please to purchase this item. Need a web account? Register with us today!
Description

Description

Sequence: NAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK
Specifications

Specifications

NP_006214
Liquid
5303
PIN4 (Human) Recombinant Protein (Q01)
NAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK
RUO
PIN4
Wheat Germ (in vitro)
GST
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.3kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
EPVH/MGC138486/PAR14/PAR17
PIN4
Yes
wheat germ expression system
SDS
Product Certifications