missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PINX1 Partial ORF (AAH15479, 1 a.a. - 100 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00054984-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16137826

  • 6150.00 SEK / 25µg
Estimated Shipment: 29-09-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: MSMLAERRRKQKWAVDPQNTAWSNDDSKFGQRMLEKMGWSKGKGLGAQEHGATDHIKVQVKNNHLGLGATINNEDNWIAHQDDFNQLLAELNTCHGQETT
Specifications

Specifications

AAH15479
Liquid
54984
PINX1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ20565/LPTL/LPTS/MGC8850
PINX1
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.41kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MSMLAERRRKQKWAVDPQNTAWSNDDSKFGQRMLEKMGWSKGKGLGAQEHGATDHIKVQVKNNHLGLGATINNEDNWIAHQDDFNQLLAELNTCHGQETT
RUO
PINX1
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers