missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human POLR2K Full-length ORF (AAH18157, 1 a.a. - 58 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00005440-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16179321

  • 3343.96 SEK / 10µg

Estimated Shipment: 02-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes one of the smallest subunits of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit is shared by the other two DNA-directed RNA polymerases. [provided by RefSeq]

Sequence: MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLAVFDAR
Specifications

Specifications

AAH18157
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
32.12kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ABC10-alpha/RPABC4/RPB10alpha/RPB12/RPB7.0/hRPB7.0/hsRPB10a
POLR2K
Yes
wheat germ expression system
Liquid
5440
POLR2K (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLAVFDAR
RUO
POLR2K
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates