missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PPARBP Partial ORF (NP_004765, 1391 a.a. - 1490 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand: Abnova™ H00005469-Q01.10ug

View more versions of this product

Product Code. 16129391

4630.00 SEK / 10µg

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. It also regulates p53-dependent apoptosis and it is essential for adipogenesis. This protein is known to have the ability to self-oligomerize. [provided by RefSeq]

Sequence: KIIISKHDGGSPSIKAKVTLQKPGESSGEGLRPQMASSKNYGSPLISGSTPKHERGSPSHSKSPAYTPQNLDSESESGSSIAEKSYQNSPSSDDGIRPLP

Specifications

Accession Number	NP_004765
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight (g/mol)	36.74kDa
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogen	KIIISKHDGGSPSIKAKVTLQKPGESSGEGLRPQMASSKNYGSPLISGSTPKHERGSPSHSKSPAYTPQNLDSESESGSSIAEKSYQNSPSSDDGIRPLP
Regulatory Status	RUO
Common Name	MED1
Species	Wheat Germ (in vitro)
Protein Tag	GST
Form	Liquid

For Use With (Application)	Antibody Production, ELISA, Protein Array, Western Blot
Gene ID (Entrez)	5469
Name	PPARBP (Human) Recombinant Protein (Q01)
Quantity	10 ug
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	CRSP1/CRSP200/DRIP205/DRIP230/MGC71488/PBP/PPARBP/PPARGBP/RB18A/TRAP220/TRIP2
Gene Symbol	MED1
Recombinant	Recombinant
Expression System	wheat germ expression system

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Abnova™ Human PPARBP Partial ORF (NP_004765, 1391 a.a. - 1490 a.a.) Recombinant Protein with GST-tag at N-terminal > 10μg

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

Abnova™ Human PPARBP Partial ORF (NP_004765, 1391 a.a. - 1490 a.a.) Recombinant Protein with GST-tag at N-terminal

Description

Specifications

Product Suggestions

Documents

Promotions