missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PPARGC1B Partial ORF (NP_573570, 914 a.a. - 1023 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand: Abnova™ H00133522-Q01.10ug

Additional Details : Weight : 0.00010kg

Product Code. 16161837

Estimated Shipment: 14-07-2022
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: SSRELKRRFEVFGEIEECEVLTRNRRGEKYGFITYRCSEHAALSLTKGAALRKRNEPSFQLSYGGLRHFCWPRYTDYDSNSEEALPASGKSKYEAMDFDSLLKEAQQSLH

Specifications

Accession Number	NP_573570
Format	Liquid
Gene ID (Entrez)	133522
Name	PPARGC1B (Human) Recombinant Protein (Q01)
Quantity	10 ug
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	ERRL1/PERC/PGC-1(beta)/PGC1B
Gene Symbol	PPARGC1B
Recombinant	Yes
Expression System	wheat germ expression system

For Use With (Application)	Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight	37.84kDa
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogen	SSRELKRRFEVFGEIEECEVLTRNRRGEKYGFITYRCSEHAALSLTKGAALRKRNEPSFQLSYGGLRHFCWPRYTDYDSNSEEALPASGKSKYEAMDFDSLLKEAQQSLH
Regulatory Status	RUO
Common Name	PPARGC1B
Host Species	Wheat Germ (in vitro)
Protein Tag	GST

Description