missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PPP1R9A Partial ORF (XP_371933, 1090 a.a. - 1188 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00055607-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16138226

  • 3343.96 SEK / 10µg

Estimated Shipment: 03-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: PCSTAQTSTRSPCMPFSWFNDSRKGSYSFRNLPAPTSSLQPSPETLISDKKGSKNFTFNDDFSPSSTSSADLSGLGAEPKTPGLSQSLALSSDESLDMI
Specifications

Specifications

XP_371933
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
PCSTAQTSTRSPCMPFSWFNDSRKGSYSFRNLPAPTSSLQPSPETLISDKKGSKNFTFNDDFSPSSTSSADLSGLGAEPKTPGLSQSLALSSDESLDMI
RUO
PPP1R9A
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
55607
PPP1R9A (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ20068/KIAA1222/NRB1/NRBI/Neurabin-I
PPP1R9A
Yes
Videos
SDS
Documents
Certificates