missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PTPRC Partial ORF (NP_002829.2, 390 a.a. - 570 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00005788-Q02.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16064635

  • 3234.00 SEK / 10µg


Estimated Shipment
08-02-2021
Add to basket

Description

Description

Sequence: PGEPQIIFCRSEAAHQGVITWNPPQRSFHNFTLCYIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSLHAYIIAKVQRNGSAAMCHFTTKSAPPSQVWNMTVSMTSDNSMHVKCRPPRDRNGPHERYHLEVEAGNTLVRNESHKNCDFRVKDLQYSTDYTFKAYFHNGDYPGEPFILHHST
Specifications

Specifications

NP_002829.2
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
45.54kDa
12.5% SDS-PAGE Stained with Coomassie Blue
PGEPQIIFCRSEAAHQGVITWNPPQRSFHNFTLCYIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSLHAYIIAKVQRNGSAAMCHFTTKSAPPSQVWNMTVSMTSDNSMHVKCRPPRDRNGPHERYHLEVEAGNTLVRNESHKNCDFRVKDLQYSTDYTFKAYFHNGDYPGEPFILHHST
RUO
PTPRC
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
5788
PTPRC (Human) Recombinant Protein (Q02)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
B220|CD45|CD45R|GP180|LCA|LY5|T200
PTPRC
Yes
Videos
SDS
Documents