missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RAB7B Partial ORF (NP_796377, 100 a.a. - 199 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand: Abnova™ H00338382-Q01.10ug

Additional Details : Weight : 0.00010kg

Product Code. 16182797

Estimated Shipment: 14-12-2021

Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: DIWRGDVLAKIVPMEQSYPMVLLGNKIDLADRKVPQEVAQGWCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQSRSRCC

Specifications

Accession Number	NP_796377
For Use With (Application)	Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight	36.74kDa
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogen	DIWRGDVLAKIVPMEQSYPMVLLGNKIDLADRKVPQEVAQGWCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQSRSRCC
Regulatory Status	RUO
Common Name	RAB7B
Host Species	Wheat Germ (in vitro)
Protein Tag	GST

Expression System	wheat germ expression system
Format	Liquid
Gene ID (Entrez)	338382
Name	RAB7B (Human) Recombinant Protein (Q01)
Quantity	10 ug
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	MGC16212/MGC9726/RAB7
Gene Symbol	RAB7B
Recombinant	Yes

Description