missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RAPGEFL1 Partial ORF (NP_057423, 1 a.a. - 99 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

4630.00 SEK - 7020.00 SEK

Specifications

Accession Number	NP_057423
For Use With (Application)	Antibody Production, ELISA, Protein Array, Western Blot
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez)	51195
Molecular Weight (g/mol)	36.63kDa

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16116716 View Documents missing translation for 'viewProductCertificates'	Abnova™ H00051195-Q01.25ug	25 μg	This item is currently unavailable or has been discontinued. View the product page for possible alternatives.		N/A

16106716 View Documents missing translation for 'viewProductCertificates'	Abnova™ H00051195-Q01.10ug	10 μg	This item is currently unavailable or has been discontinued. View the product page for possible alternatives.		N/A

Description

Sequence: MEGPEGLGRKQACLAMLLHFLDTYQGLLQEEEGAGHIIKDLYLLIMKDESLYQGLREDTLRLHQLVETVELKIPEENQPPSKQVKPLFRHFRRIDSCLQ

Specifications

Accession Number	NP_057423
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight (g/mol)	36.63kDa
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	Link-GEFII/MGC134798/MGC134799
Gene Symbol	RAPGEFL1
Recombinant	Recombinant
Expression System	wheat germ expression system

For Use With (Application)	Antibody Production, ELISA, Protein Array, Western Blot
Gene ID (Entrez)	51195
Name	RAPGEFL1 (Human) Recombinant Protein (Q01)
Immunogen	MEGPEGLGRKQACLAMLLHFLDTYQGLLQEEEGAGHIIKDLYLLIMKDESLYQGLREDTLRLHQLVETVELKIPEENQPPSKQVKPLFRHFRRIDSCLQ
Regulatory Status	RUO
Common Name	RAPGEFL1
Species	Wheat Germ (in vitro)
Protein Tag	GST
Form	Liquid

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Abnova™ Human RAPGEFL1 Partial ORF (NP_057423, 1 a.a. - 99 a.a.) Recombinant Protein with GST-tag at N-terminal

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Abnova™ Human RAPGEFL1 Partial ORF (NP_057423, 1 a.a. - 99 a.a.) Recombinant Protein with GST-tag at N-terminal

Specifications

Description

Specifications

Documents