missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RPL3L Partial ORF (NP_005052, 280 a.a. - 360 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00006123-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16134525

  • 3343.96 SEK / 10µg

Estimated Shipment: 14-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a protein that shares sequence similarity with ribosomal protein L3. The protein belongs to the L3P family of ribosomal proteins. Unlike the ubiquitous expression of ribosomal protein genes, this gene has a tissue-specific pattern of expression, with the highest levels of expression in skeletal muscle and heart. It is not currently known whether the encoded protein is a functional ribosomal protein or whether it has evolved a function that is independent of the ribosome. [provided by RefSeq]

Sequence: LNKKIFRIGRGPHMEDGKLVKNNASTSYDVTAKSITPLGGFPHYGEVNNDFVMLKGCIAGTKKRVITLRKSLLVHHSRQAV
Specifications

Specifications

NP_005052
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.65kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
LNKKIFRIGRGPHMEDGKLVKNNASTSYDVTAKSITPLGGFPHYGEVNNDFVMLKGCIAGTKKRVITLRKSLLVHHSRQAV
RUO
RPL3L
Yes
wheat germ expression system
Liquid
6123
RPL3L (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
RPL3L
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates