missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RPS6KB1 Partial ORF (NP_003152, 416 a.a. - 525 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00006198-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16184685

  • 3343.96 SEK / 10µg

Estimated Shipment: 14-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates several residues of the S6 ribosomal protein. The kinase activity of this protein leads to an increase in protein synthesis and cell proliferation. Amplification of the region of DNA encoding this gene and overexpression of this kinase are seen in some breast cancer cell lines. Alternate translational start sites have been described and alternate transcriptional splice variants have been observed but have not been thoroughly characterized. [provided by RefSeq]

Sequence: PSVLESVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
Specifications

Specifications

NP_003152
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.84kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
PSVLESVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
RUO
RPS6KB1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
6198
RPS6KB1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PS6K/S6K/S6K1/STK14A/p70(S6K)-alpha/p70-S6K/p70-alpha
RPS6KB1
Yes
Videos
SDS
Documents
Certificates