Learn More
Abnova™ Human S100A8 Partial ORF (NP_002955, 1 a.a. - 92 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
3970.00 SEK - 6025.00 SEK
Specifications
| Accession Number | NP_002955 |
|---|---|
| For Use With (Application) | Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) |
| Format | Liquid |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID (Entrez) | 6279 |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16134865
|
Abnova™
H00006279-Q01.25UG |
25 ug |
6025.00 SEK
25µg |
Estimated Shipment: 13-01-2023 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! |
16124865
|
Abnova™
H00006279-Q01.10UG |
10 ug |
3970.00 SEK
10µg |
Estimated Shipment: 13-01-2023 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! |
Description
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis. [provided by RefSeq]
Sequence: MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKSpecifications
| NP_002955 | |
| Liquid | |
| 6279 | |
| S100A8 (Human) Recombinant Protein (Q01) | |
| MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHK | |
| RUO | |
| S100A8 | |
| Wheat Germ (in vitro) | |
| GST |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 35.86kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| 60B8AG/CAGA/CFAG/CGLA/CP-10/L1Ag/MA387/MIF/MRP8/NIF/P8 | |
| S100A8 | |
| Yes | |
| wheat germ expression system |