missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SAMSN1 (aa 263-372) Control Fragment Recombinant Protein

Recombinant Protein

Brand: Invitrogen™ RP89851

Product Code. 30196688

3150.00 SEK / 100µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82571 (PA5-82571. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SAMSN (HACS1) is a member of a novel gene family of putative adaptors and scaffold proteins containing SH3 and SAM (sterile alpha motif) domains. It encodes a 441 amino acid protein that is differentially expressed in hematopoietic cells and malignancies including myeloid leukemia, lymphoma, and myeloma. SAMSN has restricted expression in human tissues. It has been shown to be up-regulated by B cell activation signals and is a participant in B cell activation and differentiation. SAMSN is an immunoinhibitory adaptor that might be a useful target for immune suppression therapy.

Specifications

Accession Number	Q9NSI8
For Use With (Application)	Blocking Assay, Control
Gene ID (Entrez)	64092
Quantity	100 μL
Gene Alias	4930571B16Rik; 930571B16Rik; HACS1; hematopoietic adapter-containing SH3 and sterile α-motif (SAM) domains 1; hematopoietic adapter-containing SH3 and sterile alpha-motif (SAM) domains 1; hematopoietic adaptor containing SH3 and SAM domains 1; Nash; NASH1; nuclear localization signals, SAM and SH3 domain containing 1; SAM and SH3 domain containing 2; SAM domain, SH3 domain and nuclear localisation signals, 1; SAM domain, SH3 domain and nuclear localization signals 1; SAM domain, SH3 domain and nuclear localization signals protein 1; SAM domain, SH3 domain and nuclear localization signals, 1; SAM domain-containing protein SAMSN-1; SAMSN; Samsn1; SAMSN-1; SASH2; SH3 protein expressed in lymphocytes 2; SH3D6B; SH3-lymphocyte protein 2; SH3-SAM adaptor protein; SLy2; Src homology domain 3 (SH3)-containing adapter protein SH3 lymphocyte protein 2
Gene Symbol	SAMSN1
Species	Human
Protein Tag	His-ABP-tag
Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Form	Liquid

Concentration	≥5.0 mg/mL
Formulation	1 M urea, PBS with no preservative; pH 7.4
Name	Human SAMSN1 (aa 263-372) Control Fragment
Regulatory Status	RUO
Common Name	SAMSN1
Conjugate	Unconjugated
Recombinant	Recombinant
Sequence	LLNGYETLEDLKDIKESHLIELNIENPDDRRRLLSAAENFLEEEIIQEQENEPEPLSLSSDISLNKSQLDDCPRDSGCYISSGNSDNGKEDLESENLSDMVHKIIITEPS
Expression System	E. coli
Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Invitrogen™ Human SAMSN1 (aa 263-372) Control Fragment Recombinant Protein > 100 μL; Unlabeled

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

Invitrogen™ Human SAMSN1 (aa 263-372) Control Fragment Recombinant Protein

Description

Specifications

Product Suggestions

Documents

Promotions