Learn More
Abnova™ Human SBLF Partial ORF (NP_006864, 529 a.a. - 620 a.a.) Recombinant Protein with GST-tag at N-terminal
Description
Endocytosis of cell surface proteins is mediated by a complex molecular machinery that assembles on the inner surface of the plasma membrane. This gene encodes one of two human homologs of the Drosophila melanogaster stoned B protein. This protein is related to components of the endocytic machinery and exhibits a modular structure consisting of an N-terminal proline-rich domain, a central region of homology specific to the human stoned B-like proteins, and a C-terminal region homologous to the mu subunits of adaptor protein (AP) complexes. Co-transcription of this gene and the neighboring downstream gene generates a rare transcript (SALF), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq]
Specifications
Specifications
Accession Number | NP_006864 |
For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene ID (Entrez) | 11037 |
Molecular Weight (g/mol) | 35.86kDa |
Name | SBLF (Human) Recombinant Protein (Q01) |
Quality Control Testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quantity | 10 μg |
Immunogen | SLKSVVVVQGAYVELQAFVNMASLAQRSSYAGSLRSCDNIRIHFPVPSQWIKALWTMNLQRQKSLKAKMNRRACLGSLQELESEPVIQVTVG |
Storage Requirements | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Show More |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.