missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SC5DL Partial ORF (NP_008849, 210 a.a. - 298 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00006309-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16184925

  • 3343.96 SEK / 10µg

Estimated Shipment: 06-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes an enzyme of cholesterol biosynthesis. The encoded protein catalyzes the conversion of lathosterol into 7-dehydrocholesterol. Mutations in this gene have been associated with lathosterolosis. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq]

Sequence: DGDFRVPQILQPFINGSAHHTDHHMFFDYNYGQYFTLWDRIGGSFKNPSSFEGKGPLSYVKEMTEGKRSSPSGNGCKNEKLFNGEFTKT
Specifications

Specifications

NP_008849
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.53kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
DGDFRVPQILQPFINGSAHHTDHHMFFDYNYGQYFTLWDRIGGSFKNPSSFEGKGPLSYVKEMTEGKRSSPSGNGCKNEKLFNGEFTKT
RUO
SC5DL
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
6309
SC5DL (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ERG3/S5DES/SC5D
SC5DL
Yes
Videos
SDS
Documents
Certificates