Learn More
Invitrogen™ Human SCN8A (aa 993-1067) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP108848
Description
Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The sodium channel protein type 8 subunit alpha (Na+ CP type VIII alpha ) is a multi-pass, transmembrane protein that mediates the sodium ion permeability of excitable membranes. The three glycoproteins that comprise the voltage-gated sodium channel proteins include a pore-forming alpha subunit, a noncovalently associated beta1 subunit and a disulfide-linked beta2 subunit. The two beta subunits regulate the level of channel expression, modulate gating and function as cell adhesion molecules for cellular aggregation and cytoskeleton interaction. The alpha subunits of sodium channels type I and III are predominantly expressed in neuronal cell bodies and proximal processes, while type II alpha subunits are more abundant along axons. Sodium channels are important for rapid signal transduction but also play a significant role in neuronal development. Defects of the SCN8A gene have exhibited detrimental effects on the growth of secondary motoneurons. Loss of SCN8A expression will result in progressive paralysis and early death.
Specifications
Q9UQD0 | |
Blocking Assay, Control | |
6334 | |
100 ÎĽL | |
AI853486; ataxia 3; C630029C19Rik; CERIII; CIAT; dmu; EIEE13; hNa6/Scn8a voltage-gated sodium channel; MED; mnd2; mnd-2; Na+ channel; naCh6; Nav1.6; Nbna1; nmf2; nmf335; nmf58; nur14; peripheral nerve protein type 4; PN4; SCN8A; Scn8a (PN4); seal; Sodium channel 6; sodium channel protein type 8 subunit alpha; Sodium channel protein type VIII subunit alpha; sodium channel voltage-gated type VIII alpha polypeptide; sodium channel, voltage gated, type VIII alpha subunit; sodium channel, voltage gated, type VIII, alpha subunit; sodium channel, voltage-gated, type 8, alpha polypeptide; sodium channel, voltage-gated, type 8, alpha subunit; sodium channel, voltage-gated, type VIII, alpha; sodium channel, voltage-gated, type VIII, alpha polypeptide; sodium voltage-gated channel alpha subunit 8; voltage-gated sodium channel subunit alpha Nav1.6; voltage-gated sodium channel type VIII alpha protein | |
Scn8a | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human SCN8A (aa 993-1067) Control Fragment | |
RUO | |
SCN8A | |
Unconjugated | |
Recombinant | |
EMNNLQISVIRIKKGVAWTKLKVHAFMQAHFKQREADEVKPLDELYEKKANCIANHTGADIHRNGDFQKNGNGTT | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.