missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SCNN1G Partial ORF (NP_001030.2, 101 a.a. - 200 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00006340-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16124985

  • 5854.80 SEK / 25µg
Estimated Shipment: 27-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Nonvoltage-gated, amiloride-sensitive, sodium channels control fluid and electrolyte transport across epithelia in many organs. These channels are heteromeric complexes consisting of 3 subunits: alpha, beta, and gamma. This gene encodes the gamma subunit, and mutations in this gene have been associated with Liddle syndrome. [provided by RefSeq]

Sequence: NINPYKYSTVRHLLADLEQETREALKSLYGFPESRKRREAESWNSVSEGKQPRFSHRIPLLIFDQDEKGKARDFFTGRKRKVGGSIIHKASNVMHIESKQ
Specifications

Specifications

NP_001030.2
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
NINPYKYSTVRHLLADLEQETREALKSLYGFPESRKRREAESWNSVSEGKQPRFSHRIPLLIFDQDEKGKARDFFTGRKRKVGGSIIHKASNVMHIESKQ
RUO
SCNN1G
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
6340
SCNN1G (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ENaCg/ENaCgamma/PHA1/SCNEG
SCNN1G
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers