missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ Human SEMA6C Partial ORF (NP_112175, 28 a.a. - 126 a.a.) Recombinant Protein with GST-tag at N-terminal Product Code.: 16132666

Abnova™ Human SEMA6C Partial ORF (NP_112175, 28 a.a. - 126 a.a.) Recombinant Protein with GST-tag at N-terminal

Product Code. 16132666
10 μg, 10µg
Click to view available options
Quantity:
10 μg
25 μg
Unit Size:
10µg
25µg
This item is not returnable. View return policy

Product Code. 16132666

Brand: Abnova™ H00010500Q01.10ug

Please to purchase this item. Need a web account? Register with us today!

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
View alternative products

This item is not returnable. View return policy

Used for AP, Array, ELISA, WB-Re

This gene product is a member of the semaphorin family of proteins. Semaphorins represent important molecular signals controlling multiple aspects of the cellular response that follows CNS injury, and thus may play an important role in neural regeneration. [provided by RefSeq]

Sequence: QDPLPLLISDLQGTSPLSWFRGLEDDAVAAELGLDFQRFLTLNRTLLVAARDHVFSFDLQAEEEGEGLVPNKYLTWRSQDVENCAVRGKLTDECYNYIR

Specifications

Accession Number NP_112175
For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 10500
Molecular Weight (g/mol) 36.63kDa
Name SEMA6C (Human) Recombinant Protein (Q01)
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 10 μg
Immunogen QDPLPLLISDLQGTSPLSWFRGLEDDAVAAELGLDFQRFLTLNRTLLVAARDHVFSFDLQAEEEGEGLVPNKYLTWRSQDVENCAVRGKLTDECYNYIR
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias SEMAY/m-SemaY/m-SemaY2
Common Name SEMA6C
Gene Symbol SEMA6C
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Expression System wheat germ expression system
Form Liquid
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
Abnova™ Human SEMA6C Partial ORF (NP_112175, 28 a.a. - 126 a.a.) Recombinant Protein with GST-tag at N-terminal >

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.