missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SEMA6C Partial ORF (NP_112175, 28 a.a. - 126 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00010500-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16132666

  • 3343.96 SEK / 10µg

Estimated Shipment: 02-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene product is a member of the semaphorin family of proteins. Semaphorins represent important molecular signals controlling multiple aspects of the cellular response that follows CNS injury, and thus may play an important role in neural regeneration. [provided by RefSeq]

Sequence: QDPLPLLISDLQGTSPLSWFRGLEDDAVAAELGLDFQRFLTLNRTLLVAARDHVFSFDLQAEEEGEGLVPNKYLTWRSQDVENCAVRGKLTDECYNYIR
Specifications

Specifications

NP_112175
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
QDPLPLLISDLQGTSPLSWFRGLEDDAVAAELGLDFQRFLTLNRTLLVAARDHVFSFDLQAEEEGEGLVPNKYLTWRSQDVENCAVRGKLTDECYNYIR
RUO
SEMA6C
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
10500
SEMA6C (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
SEMAY/m-SemaY/m-SemaY2
SEMA6C
Yes
Videos
SDS
Documents
Certificates