missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human SERCA2 ATPase (aa 8-43) Control Fragment Recombinant Protein Product Code.: 30196703
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30196703

Invitrogen™ Human SERCA2 ATPase (aa 8-43) Control Fragment Recombinant Protein

Product Code. 30196703
100 μL, 100µL
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196703

Brand: Invitrogen™ RP101984

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84558 (PA5-84558. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol into the sarcoplasmic reticulum lumen, and is involved in regulation of the contraction/relaxation cycle. Mutations in this gene cause Darier-White disease, also known as keratosis follicularis, an autosomal dominant skin disorder characterized by loss of adhesion between epidermal cells and abnormal keratinization. Alternative splicing results in multiple transcript variants encoding different isoforms.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P16615
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 488
Name Human SERCA2 ATPase (aa 8-43) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 9530097L16Rik; ATP2; Atp2a2; ATP2B; ATPase Ca++ transporting cardiac muscle slow twitch 2; ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2; ATPase, Ca++ dependent, slow-twitch, cardiac muscle-2; ATPase, Ca++ transporting, cardiac muscle, slow twitch 2; ATPase, Ca++ transporting, slow twitch 2; Ca(2+)-transport ATPase class 3; calcium ATPase; calcium pump 2; calcium-ATPase (EC 3.6.1.3); calcium-transporting ATPase; calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletal muscle isoform; cardiac Ca2+ ATPase; D5Wsu150e; DAR; DD; endoplasmic reticulum class 1/2 Ca(2+) ATPase; mKIAA4195; putative SERCA isoform; sarco(endo)plasmic reticulum Ca(2+)-dependent ATPase 2; sarco/endoplasmic reticulum Ca2+-ATPase 2; sarcoplasmic reticulum Ca2+-transport ATPase isoform; sarcoplasmic/endoplasmic reticulum calcium ATPase 2; sarcoplasmic/endoplasmic-reticulum Ca(2+) pump gene 2; SERCA; SERCA ATPase; SERCA2; Serca2a; SERCA2B; SercaII; SR Ca(2+)-ATPase 2; unnamed protein product
Common Name SERCA2 ATPase
Gene Symbol Atp2a2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TVEEVLGHFGVNESTGLSLEQVKKLKERWGSNELPA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
Invitrogen™ Human SERCA2 ATPase (aa 8-43) Control Fragment Recombinant Protein >

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.