missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SKIIP Partial ORF (NP_036377, 1 a.a. - 110 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00022938-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16116782

  • 5854.80 SEK / 25µg
Estimated Shipment: 20-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene, a member of the SNW gene family, encodes a coactivator that enhances transcription from some Pol II promoters. This coactivator can bind to the ligand-binding domain of the vitamin D receptor and to retinoid receptors to enhance vitamin D-, retinoic acid-, estrogen-, and glucocorticoid-mediated gene expression. It can also function as a splicing factor by interacting with poly(A)-binding protein 2 to directly control the expression of muscle-specific genes at the transcriptional level. Finally, the protein may be involved in oncogenesis since it interacts with a region of SKI oncoproteins that is required for transforming activity. [provided by RefSeq]

Sequence: MALTSFLPAPTQLSQDQLEAEEKARSQRSRQTSLVSSRREPPPYGYRKGWIPRLLEDFGDGGAFPEIHVAQYPLDMGRKKKMSNALAIQVDSEGKIKYDAIARQGQSKDK
Specifications

Specifications

NP_036377
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.84kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MALTSFLPAPTQLSQDQLEAEEKARSQRSRQTSLVSSRREPPPYGYRKGWIPRLLEDFGDGGAFPEIHVAQYPLDMGRKKKMSNALAIQVDSEGKIKYDAIARQGQSKDK
RUO
SNW1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
22938
SKIIP (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Bx42/MGC119379/NCOA-62/PRPF45/Prp45/SKIIP/SKIP
SNW1
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers