Learn More
Abnova™ Human SLC12A2 Partial ORF (NP_001037.1, 903 a.a. - 1010 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00006558-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
By moving chloride into epithelial cells, the Na-K-Cl cotransporter SLC12A2 aids transcellular movement of chloride across both secretory and absorptive epithelia (Payne et al., 1995 [PubMed 7629105]). See also SLC12A1 (MIM 600839) and SLC12A3 (MIM 600968).[supplied by OMIM]
Sequence: YINLFHDAFDIQYGVVVIRLKEGLDISHLQGQEELLSSQEKSPGTKDVVVSVEYSKKSDLDTSKPLSEKPITHKVEEEDGKTATQPLLKKESKGPIVPLNVADQKLLESpecifications
NP_001037.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
37.62kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
YINLFHDAFDIQYGVVVIRLKEGLDISHLQGQEELLSSQEKSPGTKDVVVSVEYSKKSDLDTSKPLSEKPITHKVEEEDGKTATQPLLKKESKGPIVPLNVADQKLLE | |
RUO | |
SLC12A2 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
6558 | |
SLC12A2 (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
BSC/BSC2/MGC104233/NKCC1 | |
SLC12A2 | |
Recombinant | |
wheat germ expression system |