missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ Human SLC12A2 Partial ORF (NP_001037.1, 903 a.a. - 1010 a.a.) Recombinant Protein with GST-tag at N-terminal Product Code.: 16185425
  1. Home
  2. Products
  3. Recombinant Proteins
  4. Abnova™ Human SLC12A2 Partial ORF (NP_001037.1, 903 a.a. - 1010 a.a.) Recombinant Protein with GST-tag at N-terminal

Abnova™ Human SLC12A2 Partial ORF (NP_001037.1, 903 a.a. - 1010 a.a.) Recombinant Protein with GST-tag at N-terminal

Product Code. 16185425
25 ug, 25µg
Click to view available options
Quantity:
10 ug
25 ug
Unit Size:
10µg
25µg
This item is not returnable. View return policy

Product Code. 16185425

Brand: Abnova™ H00006558Q01.25ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Used for AP, Array, ELISA, WB-Re

By moving chloride into epithelial cells, the Na-K-Cl cotransporter SLC12A2 aids transcellular movement of chloride across both secretory and absorptive epithelia (Payne et al., 1995 [PubMed 7629105]). See also SLC12A1 (MIM 600839) and SLC12A3 (MIM 600968).[supplied by OMIM]

Sequence: YINLFHDAFDIQYGVVVIRLKEGLDISHLQGQEELLSSQEKSPGTKDVVVSVEYSKKSDLDTSKPLSEKPITHKVEEEDGKTATQPLLKKESKGPIVPLNVADQKLLE

Specifications

Accession Number NP_001037.1
For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 6558
Molecular Weight (g/mol) 37.62kDa
Name SLC12A2 (Human) Recombinant Protein (Q01)
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 25 ug
Immunogen YINLFHDAFDIQYGVVVIRLKEGLDISHLQGQEELLSSQEKSPGTKDVVVSVEYSKKSDLDTSKPLSEKPITHKVEEEDGKTATQPLLKKESKGPIVPLNVADQKLLE
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias BSC/BSC2/MGC104233/NKCC1
Common Name SLC12A2
Gene Symbol SLC12A2
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Expression System wheat germ expression system
Form Liquid
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
Abnova™ Human SLC12A2 Partial ORF (NP_001037.1, 903 a.a. - 1010 a.a.) Recombinant Protein with GST-tag at N-terminal >

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.