missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SLC7A8 Partial ORF (NP_036376.2, 467 a.a. - 535 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand: Abnova™ H00023428-Q01.10ug

Additional Details : Weight : 0.00010kg

Product Code. 16184666

Estimated Shipment: 07-12-2021

Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: VYWQHKPKCFSDFIELLTLVSQKMCVVVYPEVERGSGTEEANEDMEEQQQPMYQPTPTKDKDVAGQPQP

Specifications

Accession Number	NP_036376.2
For Use With (Application)	Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight	33.33kDa
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogen	VYWQHKPKCFSDFIELLTLVSQKMCVVVYPEVERGSGTEEANEDMEEQQQPMYQPTPTKDKDVAGQPQP
Regulatory Status	RUO
Common Name	SLC7A8
Host Species	Wheat Germ (in vitro)
Protein Tag	GST

Expression System	wheat germ expression system
Format	Liquid
Gene ID (Entrez)	23428
Name	SLC7A8 (Human) Recombinant Protein (Q01)
Quantity	10 ug
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	LAT2/LPI-PC1
Gene Symbol	SLC7A8
Recombinant	Yes

Description