missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SNX7 Partial ORF (NP_057060, 120 a.a. - 226 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00051375-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16176916

  • 5030.41 SEK / 25µg

Estimated Shipment: 09-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region like some family members, and its function is unknown. This gene results in two transcript variants encoding two distinct isoforms. [provided by RefSeq]

Sequence: ALHKFLNRIADHPTLTFNEDFKIFLTAQAWELSPHKKQGPGLLSRMGQTVRAVASSMRGVKNRPEEFMEMNNFIELFSQKINLIDKISQRIYKEEREYFDEMKEYGP
Specifications

Specifications

NP_057060
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.51kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
ALHKFLNRIADHPTLTFNEDFKIFLTAQAWELSPHKKQGPGLLSRMGQTVRAVASSMRGVKNRPEEFMEMNNFIELFSQKINLIDKISQRIYKEEREYFDEMKEYGP
RUO
SNX7
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
51375
SNX7 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DKFZp564F052/MGC8717
SNX7
Yes
Videos
SDS
Documents
Certificates