missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SPANXA1 Full-length ORF (AAI48760.1, 1 a.a. - 97 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00030014-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16139312

  • 4055.00 SEK / 10µg
Estimated Shipment: 29-09-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Temporally regulated transcription and translation of several testis-specific genes is required to initiate the series of molecular and morphological changes in the male germ cell lineage necessary for the formation of mature spermatozoa. This gene is a member of the SPANX family of cancer/testis-associated genes, which are located in a cluster on chromosome X. The SPANX genes encode differentially expressed testis-specific proteins that localize to various subcellular compartments. This particular gene maps to chromosome X in a head-to-head orientation with SPANX family member A2, which appears to be a duplication of the A1 locus. The protein encoded by this gene targets to the nucleus where it associates with nuclear vacuoles and the redundant nuclear envelope. Based on its association with these poorly characterized regions of the sperm nucleus, this protein provides a biochemical marker to study unique structures in spermatazoa while attempting to further define its role in spermatogenesis. [provided by RefSeq]

Sequence: MDKQSSAGGVKRSVPCDSNEANEMMPETPTGDSDPQPAPKKMKTSESSTILVVRYRRNFKRTSPEELLNDHARENRINPLQMEEEEFMEIMVEIPAK
Specifications

Specifications

AAI48760.1
Liquid
30014
SPANXA1 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MDKQSSAGGVKRSVPCDSNEANEMMPETPTGDSDPQPAPKKMKTSESSTILVVRYRRNFKRTSPEELLNDHARENRINPLQMEEEEFMEIMVEIPAK
RUO
SPANXA1
Wheat Germ (in vitro)
GST
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.62kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
NAP-X/SPAN-Xa/SPAN-Xb/SPANX/SPANX-A2/SPANX-C/SPANX-D/SPANXA2/SPANXC/SPANXD
SPANXA1
Yes
wheat germ expression system
Videos
SDS
Documents
Certificates
Special Offers

Special Offers