Learn More
Abnova™ Human SRP68 Partial ORF (NP_055045.2, 531 a.a. - 627 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00006730-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
The signal recognition particle (SRP) is a ribonucleoprotein complex that transports secreted and membrane proteins to the endoplasmic reticulum for processing. The complex includes a 7S RNA and six protein subunits. This gene encodes the 68kDa component of the SRP. Alternatively spliced transcript variants have been identified, but their biological validity has not been determined. Three related pseudogenes are located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq]
Sequence: AILDANDAHQTETSSSQVKDNKPLVERFETFCLDPSLVTKQANLVHFPPGFQPIPCKPLFFDLALNHVAFPPLEDKLEQKTKSGLTGYIKGIFGFRSSpecifications
| NP_055045.2 | |
| Liquid | |
| 6730 | |
| SRP68 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| SRP68 | |
| Wheat Germ (in vitro) | |
| GST |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.41kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| AILDANDAHQTETSSSQVKDNKPLVERFETFCLDPSLVTKQANLVHFPPGFQPIPCKPLFFDLALNHVAFPPLEDKLEQKTKSGLTGYIKGIFGFRS | |
| RUO | |
| SRP68 | |
| Yes | |
| wheat germ expression system |