missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TAF1 (aa 1748-1870) Control Fragment Recombinant Protein

Recombinant Protein

Brand: Invitrogen™ RP91898

Product Code. 30197118

3150.00 SEK / 100µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-81918 (PA5-81918. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

3-Phosphoglycerate dehydrogenase (PHGDH; EC 1.1.1.95) catalyzes the transition of 3-phosphoglycerate into 3-phosphohydroxypyruvate, which is the first and rate-limiting step in the phosphorylated pathway of serine biosynthesis, using NAD+/NADH as a cofactor.

Specifications

Accession Number	P21675
For Use With (Application)	Blocking Assay, Control
Gene ID (Entrez)	6872
Quantity	100 μL
Gene Alias	AU015687; B430306D02Rik; BA2R; Ccg1; Ccg-1; CCGS; Cell cycle gene 1 protein; cell cycle, G1 phase defect; complementation of cell cycle block, G1-to-S; DYT3; DYT3/TAF1; KAT4; MRXS33; NSCL2; N-TAF1; OF; P250; RGD1562050; TAF(II)250; TAF1; TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor; TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 250 kDa; TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor, neuron specific isoform; Taf2a; TAFII250; TAFII-250; TATA box binding protein associated factor 1; TATA-box binding protein associated factor 1; TBP-associated factor 250 kDa; transcription factor TFIID p250 polypeptide; transcription initiation factor TFIID 250 kDa subunit; Transcription initiation factor TFIID subunit 1; XDP
Gene Symbol	TAF1
Species	Human
Protein Tag	His-ABP-tag
Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Form	Liquid

Concentration	≥5.0 mg/mL
Formulation	1 M urea, PBS with no preservative; pH 7.4
Name	Human TAF1 (aa 1748-1870) Control Fragment
Regulatory Status	RUO
Common Name	TAF1
Conjugate	Unconjugated
Recombinant	Recombinant
Sequence	SDSDVGSGGIRPKQPRMLQENTRMDMENEESMMSYEGDGGEASHGLEDSNISYGSYEEPDPKSNTQDTSFSSIGGYEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDS
Expression System	E. coli
Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Invitrogen™ Human TAF1 (aa 1748-1870) Control Fragment Recombinant Protein > 100 μL; Unlabeled

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

Invitrogen™ Human TAF1 (aa 1748-1870) Control Fragment Recombinant Protein

Description

Specifications

Product Suggestions

Documents

Promotions