missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ Human TFAP2A Partial ORF (AAH17754, 99 a.a. - 205 a.a.) Recombinant Protein with GST-tag at N-terminal Product Code.: 16136485

Abnova™ Human TFAP2A Partial ORF (AAH17754, 99 a.a. - 205 a.a.) Recombinant Protein with GST-tag at N-terminal

Product Code. 16136485
10 ug, 10µg
missing translation for 'orderingAttributeHoverText'
Quantity:
10 ug
25 ug
missing translation for 'unitSize'
10µg
25µg
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Product Code. 16136485

Brand: Abnova™ H00007020Q01.10ug

Please to purchase this item. Need a web account? Register with us today!

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
View alternative products

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Used for AP, Array, ELISA, WB-Re

AP2-alpha is a 52-kD retinoic acid-inducible and developmentally regulated activator of transcription that binds to a consensus DNA-binding sequence CCCCAGGC in the SV40 and metallothionein (MIM 156350) promoters.[supplied by OMIM]

Sequence: SGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVF

Spécification

Accession Number AAH17754
For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 7020
Molecular Weight (g/mol) 37.40kDa
Name TFAP2A (Human) Recombinant Protein (Q01)
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 10 ug
Immunogen SGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVF
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias AP-2/AP-2alpha/AP2TF/BOFS/TFAP2
Common Name TFAP2A
Gene Symbol TFAP2A
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Expression System wheat germ expression system
Form Liquid
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit
Abnova™ Human TFAP2A Partial ORF (AAH17754, 99 a.a. - 205 a.a.) Recombinant Protein with GST-tag at N-terminal >

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis