missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TGM2 Partial ORF (AAH03551, 1 a.a. - 120 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

3970.00 SEK - 6025.00 SEK

Specifications

Accession Number AAH03551
For Use With (Application) Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Format Liquid
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 7052
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
16136615
View Documents Promotion Details
Abnova™
H00007052-Q01.25UG
25 ug
6025.00 SEK
25µg
View alternative products
Save Up to 
»
Estimated Shipment: 13-01-2023
to see stock.
Please to purchase this item. Need a web account? Register with us today!
16126615
View Documents Promotion Details
Abnova™
H00007052-Q01.10UG
10 ug
3970.00 SEK
10µg
View alternative products
Save Up to 
»
Estimated Shipment: 13-01-2023
to see stock.
Please to purchase this item. Need a web account? Register with us today!
Description

Description

Transglutaminases are enzymes that catalyze the crosslinking of proteins by epsilon-gamma glutamyl lysine isopeptide bonds. While the primary structure of transglutaminases is not conserved, they all have the same amino acid sequence at their active sites and their activity is calcium-dependent. The protein encoded by this gene acts as a monomer, is induced by retinoic acid, and appears to be involved in apoptosis. Finally, the encoded protein is the autoantigen implicated in celiac disease. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFSVVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLE
Specifications

Specifications

AAH03551
Liquid
7052
TGM2 (Human) Recombinant Protein (Q01)
MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFSVVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLE
RUO
TGM2
Wheat Germ (in vitro)
GST
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
38.83kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
G-ALPHA-h/GNAH/TG2/TGC
TGM2
Yes
wheat germ expression system
SDS
Product Certifications