Learn More
Abnova™ Human THRAP2 Partial ORF (NP_056150, 1186 a.a. - 1285 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00023389-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
The evolutionarily conserved THRAP genes encode a family of proteins that regulate embryonic development. THRAP2 is involved in early development of the heart and brain (Muncke et al., 2003 [PubMed 14638541]).[supplied by OMIM]
Sequence: IFGKNSDIGQAAERRLMMCQSTFLPQVEGTKKPQEPPISLLLLLQNQHTQPFASLNFLDYISSNNRQTLPCVSWSYDRVQADNNDYWTECFNALEQGRQYSpecifications
| NP_056150 | |
| Liquid | |
| 23389 | |
| THRAP2 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| DKFZp781D0112/FLJ21627/KIAA1025/PROSIT240/THRAP2/TRAP240L | |
| MED13L | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.74kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| IFGKNSDIGQAAERRLMMCQSTFLPQVEGTKKPQEPPISLLLLLQNQHTQPFASLNFLDYISSNNRQTLPCVSWSYDRVQADNNDYWTECFNALEQGRQY | |
| RUO | |
| MED13L | |
| Wheat Germ (in vitro) | |
| GST |