missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TMOD3 Partial ORF (NP_055362, 280 a.a. - 352 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand: Abnova™ H00029766-Q01.10ug

Additional Details : Weight : 0.00010kg

Product Code. 16116066

Estimated Shipment: 07-07-2022
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: RDNETLAELKIDNQRQQLGTAVELEMAKMLEENTNILKFGYQFTQQGPRTRAANAITKNNDLVRKRRVEGDHQ

Specifications

Accession Number	NP_055362
Format	Liquid
Gene ID (Entrez)	29766
Name	TMOD3 (Human) Recombinant Protein (Q01)
Quantity	10 ug
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	UTMOD
Gene Symbol	TMOD3
Recombinant	Yes
Expression System	wheat germ expression system

For Use With (Application)	Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight	33.77kDa
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogen	RDNETLAELKIDNQRQQLGTAVELEMAKMLEENTNILKFGYQFTQQGPRTRAANAITKNNDLVRKRRVEGDHQ
Regulatory Status	RUO
Common Name	TMOD3
Host Species	Wheat Germ (in vitro)
Protein Tag	GST

Description