missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ Human TNFRSF19 Partial ORF (NP_061117, 30 a.a. - 119 a.a.) Recombinant Protein with GST-tag at N-terminal Product Code.: 16138156
  1. Home
  2. Products
  3. Recombinant Proteins
  4. Abnova™ Human TNFRSF19 Partial ORF (NP_061117, 30 a.a. - 119 a.a.) Recombinant Protein with GST-tag at N-terminal

Abnova™ Human TNFRSF19 Partial ORF (NP_061117, 30 a.a. - 119 a.a.) Recombinant Protein with GST-tag at N-terminal

Product Code. 16138156
10 μg, 10µg
Click to view available options
Quantity:
10 μg
25 μg
Unit Size:
10µg
25µg
This item is not returnable. View return policy

Product Code. 16138156

Brand: Abnova™ H00055504Q01.10ug

Please to purchase this item. Need a web account? Register with us today!

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
 View alternative products

This item is not returnable. View return policy

Description

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is highly expressed during embryonic development. It has been shown to interact with TRAF family members, and to activate JNK signaling pathway when overexpressed in cells. This receptor is capable of inducing apoptosis by a caspase-independent mechanism, and it is thought to play an essential role in embryonic development. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq]

Sequence: ESGDCRQQEFRDRSGNCVPCNQCGPGMELSKECGFGYGEDAQCVTCRLHRFKEDWGFQKCKPCLDCAVVNRFQKANCSATSDAICGDCLP

Specifications

Accession Number NP_061117
For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 55504
Molecular Weight (g/mol) 35.64kDa
Name TNFRSF19 (Human) Recombinant Protein (Q01)
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 10 μg
Immunogen ESGDCRQQEFRDRSGNCVPCNQCGPGMELSKECGFGYGEDAQCVTCRLHRFKEDWGFQKCKPCLDCAVVNRFQKANCSATSDAICGDCLP
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias TAJ/TAJ-alpha/TRADE/TROY
Common Name TNFRSF19
Gene Symbol TNFRSF19
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Expression System wheat germ expression system
Form Liquid
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
Abnova™ Human TNFRSF19 Partial ORF (NP_061117, 30 a.a. - 119 a.a.) Recombinant Protein with GST-tag at N-terminal >

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.