missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TNKS2 Partial ORF (NP_079511, 1068 a.a. - 1166 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand: Abnova™ H00080351-Q01.10ug

Product Code. 16170297

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
View alternative products »

This item is not returnable. View return policy

Description

Sequence: SNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPEGMVDG

Specifications

Accession Number	NP_079511
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight (g/mol)	36.63kDa
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogen	SNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPEGMVDG
Regulatory Status	RUO
Common Name	TNKS2
Species	Wheat Germ (in vitro)
Protein Tag	GST
Form	Liquid

For Use With (Application)	Antibody Production, ELISA, Protein Array, Western Blot
Gene ID (Entrez)	80351
Name	TNKS2 (Human) Recombinant Protein (Q01)
Quantity	10 μg
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	PARP-5b/PARP-5c/PARP5B/PARP5C/TANK2/TNKL
Gene Symbol	TNKS2
Recombinant	Recombinant
Expression System	wheat germ expression system

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Abnova™ Human TNKS2 Partial ORF (NP_079511, 1068 a.a. - 1166 a.a.) Recombinant Protein with GST-tag at N-terminal > 10μg

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

Abnova™ Human TNKS2 Partial ORF (NP_079511, 1068 a.a. - 1166 a.a.) Recombinant Protein with GST-tag at N-terminal

Description

Specifications

Product Suggestions

Documents

Special Offers