Learn More
Abnova™ Human TRIP11 Partial ORF (NP_004230.1, 1756 a.a. - 1855 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00009321-Q01.25ug
Description
TRIP11 was first identified through its ability to interact functionally with thyroid hormone receptor-beta (THRB; MIM 190160). It has also been found in association with the Golgi apparatus and microtubules.[supplied by OMIM]
Sequence: LRQEMLDDVQKKLMSLANSSEGKVDKVLMRNLFIGHFHTPKNQRHEVLRLMGSILGVRREEMEQLFHDDQGSVTRWMTGWLGGGSKSVPNTPLRPNQQSVSpecifications
NP_004230.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.74kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
LRQEMLDDVQKKLMSLANSSEGKVDKVLMRNLFIGHFHTPKNQRHEVLRLMGSILGVRREEMEQLFHDDQGSVTRWMTGWLGGGSKSVPNTPLRPNQQSV | |
RUO | |
TRIP11 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
9321 | |
TRIP11 (Human) Recombinant Protein (Q01) | |
25 ÎĽg | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
CEV14/GMAP-210/TRIP230 | |
TRIP11 | |
Recombinant | |
wheat germ expression system |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.