missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human TRPM4 (aa 266-359) Control Fragment Recombinant Protein Product Code.: 30181397

Invitrogen™ Human TRPM4 (aa 266-359) Control Fragment Recombinant Protein

Product Code. 30181397
100 μL, 100µL
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30181397

Brand: Invitrogen™ RP98433

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111134 (PA5-111134. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Calcium-activated non selective (CAN) cation channel that mediates membrane depolarization. While it is activated by increase in intracellular Ca2+, it is impermeable to it. Mediates transport of monovalent cations (Na+, K+, Cs+, Li+), leading to depolarize the membrane. It thereby plays a central role in cadiomyocytes, neurons from entorhinal cortex, dorsal root and vomeronasal neurons, endocrine pancreas cells, kidney epithelial cells, cochlea hair cells etc. Participates in T-cell activation by modulating Ca2+ oscillations after T lymphocyte activation, which is required for NFAT-dependent IL2 production. Involved in myogenic constriction of cerebral arteries. Controls insulin secretion in pancreatic beta-cells. May also be involved in pacemaking or could cause irregular electrical activity under conditions of Ca2+ overload. Affects T-helper 1 (Th1) and T-helper 2 (Th2) cell motility and cytokine production through differential regulation of calcium signaling and NFATC1 localization. Enhances cell proliferation through up-regulation of the beta-catenin signaling pathway.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8TD43
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 54795
Name Human TRPM4 (aa 266-359) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110030C19Rik; AW047689; Calcium-activated non-selective cation channel 1; H LTrpC-4; hTRPM4; Long transient receptor potential channel 4; LOW QUALITY PROTEIN: transient receptor potential cation channel subfamily M member 4; LTrpC4; LTrpC-4; melastatin like 2 protein; melastatin-4; Melastatin-like 2; MLS2s; PFHB1B; transient receptor potential cation channel subfamily M member 4; transient receptor potential cation channel, subfamily M, member 4; transient receptor potential ion channel melastatin subgroup member 4; Trpm4; TRPM4B
Common Name TRPM4
Gene Symbol TRPM4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GTGIDIPVLLLLIDGDEKMLTRIENATQAQLPCLLVAGSGGAADCLAETLEDTLAPGSGGARQGEARDRIRRFFPKGDLEVLQAQVERIMTRKE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
Invitrogen™ Human TRPM4 (aa 266-359) Control Fragment Recombinant Protein >

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.