missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TSC22D1 Full-length ORF (AAH16867, 1 a.a. - 144 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00008848-P02.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16122992

  • 6150.00 SEK / 25µg
Estimated Shipment: 14-07-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

TSC22D1 encodes a transcription factor and belongs to the large family of early response genes.[supplied by OMIM]

Sequence: MKSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGPTA
Specifications

Specifications

AAH16867
Liquid
8848
TSC22D1 (Human) Recombinant Protein (P02)
12.5% SDS-PAGE Stained with Coomassie Blue.
MKSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGPTA
RUO
TSC22D1
Wheat Germ (in vitro)
GST
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
41.58kDa
Glutathione Sepharose 4 Fast Flow
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DKFZp686O19206/MGC17597/RP11-269C23.2/TGFB1I4/TSC22
TSC22D1
Yes
wheat germ expression system
Videos
SDS
Documents
Certificates
Special Offers

Special Offers