missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human TUSC2 Partial ORF (NP_009206, 31 a.a. - 110 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00011334-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
This gene is a highly conserved lung cancer candidate gene. No other information about this gene is currently available. [provided by RefSeq]
Sequence: ALVRPRGRAVPPFVFTRRGSMFYDEDGDLAHEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDHPRIHVDFPVILYEVSpecifications
| NP_009206 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 34.54kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| ALVRPRGRAVPPFVFTRRGSMFYDEDGDLAHEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDHPRIHVDFPVILYEV | |
| RUO | |
| TUSC2 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 11334 | |
| TUSC2 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| C3orf11/FUS1/PAP/PDAP2 | |
| TUSC2 | |
| Recombinant | |
| wheat germ expression system |