Learn More
Abnova™ Human TWIST1 Partial ORF (NP_000465.1, 106 a.a. - 174 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00007291-Q02.25ug
Additional Details : Weight : 0.00010kg
Description
Basic helix-loop-helix (bHLH) transcription factors have been implicated in cell lineage determination and differentiation. The protein encoded by this gene is a bHLH transcription factor and shares similarity with another bHLH transcription factor, Dermo1. The strongest expression of this mRNA is in placental tissue; in adults, mesodermally derived tissues express this mRNA preferentially. Mutations in this gene have been found in patients with Saethre-Chotzen syndrome. [provided by RefSeq]
Sequence: LQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASSpecifications
NP_000465.1 | |
Liquid | |
7291 | |
TWIST1 (Human) Recombinant Protein (Q02) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
ACS3/BPES2/BPES3/SCS/TWIST/bHLHa38 | |
TWIST1 | |
Yes | |
wheat germ expression system |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
33.22kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
LQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMAS | |
RUO | |
TWIST1 | |
Wheat Germ (in vitro) | |
GST |