missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human UBE2C Partial ORF (AAH16292.1, 25 a.a. - 129 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

3860.70 SEK - 5854.80 SEK

Specifications

Name UBE2C (Human) Recombinant Protein (Q02)
Recombinant Yes
For Use With (Application) Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Molecular Weight 37.29kDa
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
16045295
View Documents Promotion Details
Abnova™
H00011065-Q02.10UG
10 ug
3860.70 SEK
10µg
View alternative products
Save Up to 
»
Estimated Shipment: 16-03-2022
Please to purchase this item. Need a web account? Register with us today!
16055295
View Documents Promotion Details
Abnova™
H00011065-Q02.25UG
25 ug
5854.80 SEK
25µg
View alternative products
Save Up to 
»
Estimated Shipment: 16-03-2022
Please to purchase this item. Need a web account? Register with us today!
Description

Description

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for the destruction of mitotic cyclins and for cell cycle progression. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: GAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVR
Specifications

Specifications

UBE2C (Human) Recombinant Protein (Q02)
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Yes
37.29kDa
SDS
Product Certifications