missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human UBE2C Partial ORF (AAH16292.1, 25 a.a. - 129 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

4630.00 SEK - 7020.00 SEK

Specifications

Accession Number	AAH16292.1
For Use With (Application)	Antibody Production, ELISA, Protein Array, Western Blot
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez)	11065
Molecular Weight (g/mol)	37.29kDa

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16045295 View Documents missing translation for 'viewProductCertificates'	Abnova™ H00011065-Q02.10ug	10 μg	This item is currently unavailable or has been discontinued. View the product page for possible alternatives.		N/A

16055295 View Documents missing translation for 'viewProductCertificates'	Abnova™ H00011065-Q02.25ug	25 μg	This item is currently unavailable or has been discontinued. View the product page for possible alternatives.		N/A

Description

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for the destruction of mitotic cyclins and for cell cycle progression. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: GAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVR

Specifications

Accession Number	AAH16292.1
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight (g/mol)	37.29kDa
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	UBCH10/dJ447F3.2
Gene Symbol	UBE2C
Recombinant	Recombinant
Expression System	wheat germ expression system

For Use With (Application)	Antibody Production, ELISA, Protein Array, Western Blot
Gene ID (Entrez)	11065
Name	UBE2C (Human) Recombinant Protein (Q02)
Immunogen	GAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVR
Regulatory Status	RUO
Common Name	UBE2C
Species	Wheat Germ (in vitro)
Protein Tag	GST
Form	Liquid

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Abnova™ Human UBE2C Partial ORF (AAH16292.1, 25 a.a. - 129 a.a.) Recombinant Protein with GST-tag at N-terminal

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Abnova™ Human UBE2C Partial ORF (AAH16292.1, 25 a.a. - 129 a.a.) Recombinant Protein with GST-tag at N-terminal

Specifications

Description

Specifications

Documents