missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ Human UCK2 Full-length ORF (AAH02906, 1 a.a. - 261 a.a.) Recombinant Protein with GST-tag at N-terminal Product Code.: 16161752
  1. Home
  2. Products
  3. Recombinant Proteins
  4. Abnova™ Human UCK2 Full-length ORF (AAH02906, 1 a.a. - 261 a.a.) Recombinant Protein with GST-tag at N-terminal

Abnova™ Human UCK2 Full-length ORF (AAH02906, 1 a.a. - 261 a.a.) Recombinant Protein with GST-tag at N-terminal

Product Code. 16161752
10 μg, 10µg
Click to view available options
Quantity:
10 μg
25 μg
Unit Size:
10µg
25µg
This item is not returnable. View return policy

Product Code. 16161752

Brand: Abnova™ H00007371P01.10ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene catalyzes the phosphorylation of uridine monophosphate to uridine diphosphate. This is the first step in the production of the pyrimidine nucleoside triphosphates required for RNA and DNA synthesis. In addition, an allele of this gene may play a role in mediating nonhumoral immunity to Hemophilus influenzae type B. [provided by RefSeq]

Sequence: MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTPKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGPSKRQTNGCLNGYTPSRKR*ASESSSRPH

Specifications

Accession Number AAH02906
For Use With (Application) Antibody Production, Protein Array, ELISA, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 7371
Molecular Weight (g/mol) 54.45kDa
Name UCK2 (Human) Recombinant Protein (P01)
Purification Method Glutathione Sepharose 4 Fast Flow
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 10 μg
Immunogen MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTPKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGPSKRQTNGCLNGYTPSRKR*ASESSSRPH
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias TSA903/UK/UMPK
Common Name UCK2
Gene Symbol UCK2
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Expression System wheat germ expression system
Form Liquid
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
Abnova™ Human UCK2 Full-length ORF (AAH02906, 1 a.a. - 261 a.a.) Recombinant Protein with GST-tag at N-terminal >

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.